DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and MRPL35

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_010608.1 Gene:MRPL35 / 851921 SGDID:S000002730 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:48/244 - (19%)
Similarity:88/244 - (36%) Gaps:72/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PIFAFIASQ--RQYSCEKVGKTMEEHCVVPDVI----------AKAPAQTAVVEYPGDIVVKPGQ 112
            |::..:..|  ..|....:.:.:|....:||.:          .|.|..|.|.::     ::||:
Yeast   137 PVYRHLGKQHWESYGQMLLMQRLETLAAIPDTLPTLVPRAEVNIKFPFSTGVNKW-----IEPGE 196

  Fly   113 VLTPTQVKDEPCVKWE----ADANK-LYTLCMTDPDAPSRKDPKF-------------------- 152
            .|:.......|..|.:    .:..| |||:.:.:||.|...:..|                    
Yeast   197 FLSSNVTSMRPIFKIQEYELVNVEKQLYTVLIVNPDVPDLSNDSFKTALCYGLVNINLTYNDNLI 261

  Fly   153 --REWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRC--------KLTFDEK 207
              |::|             ...:::.|:...|..:.|..|:|..::.|..        .|..|.|
Yeast   262 DPRKFH-------------SSNIIADYLPPVPEKNAGKQRFVVWVFRQPLIEDKQGPNMLEIDRK 313

  Fly   208 RLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPILYKQLG 256
            .|      .|..|.|.:|.|||.| ..|..:::::|:|..|..:.::.|
Yeast   314 EL------SRDDFDIRQFTKKYNL-TAIGAHIWRSEWDAKVAAVREKYG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 34/176 (19%)
MRPL35NP_010608.1 PEBP_euk 178..341 CDD:176644 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.