DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and YLR179C

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_013280.1 Gene:YLR179C / 850876 SGDID:S000004169 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:51/143 - (35%)
Similarity:71/143 - (49%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PTQVKDEPCVKWEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNI-----PGGDVA---KGE 172
            || :|..|..|.:..|.....|.|||||||||.:.|:.|..|:::.:|     ||||:|   ||.
Yeast    55 PT-IKFTPFDKSQLSAEDKLALLMTDPDAPSRTEHKWSEVCHYIITDIPVEYGPGGDIAISGKGV 118

  Fly   173 VLSAYVGSGPPPDTGLHRYVFLIYEQRCK-------LTFDEKRLPNNSGDGRGGFKIAEFAKKYA 230
            |.:.|:|.|||.::|.|||||.:    ||       .||.:.....:.|.|..|....::.|:..
Yeast   119 VRNNYIGPGPPKNSGYHRYVFFL----CKQPKGADSSTFTKVENIISWGYGTPGAGAYDYIKENN 179

  Fly   231 LGNPIAGNLYQAE 243
            | ..:..|.|..|
Yeast   180 L-QLVGANYYMVE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 50/140 (36%)
YLR179CNP_013280.1 PEBP_euk 30..190 CDD:176644 50/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm46533
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.