DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and TFS1

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_013279.1 Gene:TFS1 / 850875 SGDID:S000004168 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:56/203 - (27%)
Similarity:91/203 - (44%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEHCVVPDVI---AKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKW-----------EADA 131
            ::|.::.|||   :..|:....|||.....|..|..|...:.:.:|..::           :|:|
Yeast    16 KKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQANA 80

  Fly   132 -----NKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSA--------------- 176
                 :.|:||.||||||||:.|.|:.|:.|.:..::...:.|..|...|               
Yeast    81 YVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSNT 145

  Fly   177 ---YVGSGPPPDTGLHRYVFLIYEQRCKL---TFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPI 235
               |:|..||..:|.||||||:|:|...:   .|.:.:...|.|.|.....:.::||:..| ..:
Yeast   146 LIEYMGPAPPKGSGPHRYVFLLYKQPKGVDSSKFSKIKDRPNWGYGTPATGVGKWAKENNL-QLV 209

  Fly   236 AGNLYQAE 243
            |.|.:.||
Yeast   210 ASNFFYAE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 49/178 (28%)
TFS1NP_013279.1 PEBP_euk 36..216 CDD:176644 49/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm46533
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.