DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and FT

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT / 842859 AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana


Alignment Length:211 Identity:66/211 - (31%)
Similarity:97/211 - (45%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAIRTLKTFSNSILTKEPKPIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKA--PAQTAV---V 100
            |..:|.||  .:|.|::| |:         .|..|:...:.:..:|..|:...  |...::   |
plant    22 AETKTSKT--ETINTEKP-PV---------CSRSKMSINIRDPLIVSRVVGDVLDPFNRSITLKV 74

  Fly   101 EYPGDIVVKPGQVLTPTQVKDEPCVK-WEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIP 164
            .| |...|..|..|.|:||:::|.|: ...|....|||.|.|||.||..:|..||:.||||.:||
plant    75 TY-GQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIP 138

  Fly   165 G--GDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAK 227
            .  |.....|:: .|  ..|.|..|:||.||:::.|..:.|.       .:...|..|...|||:
plant   139 ATTGTTFGNEIV-CY--ENPSPTAGIHRVVFILFRQLGRQTV-------YAPGWRQNFNTREFAE 193

  Fly   228 KYALGNPIAGNLYQAE 243
            .|.||.|:|...|..:
plant   194 IYNLGLPVAAVFYNCQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 53/144 (37%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.