DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and E12A11

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 / 838390 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana


Alignment Length:160 Identity:51/160 - (31%)
Similarity:83/160 - (51%) Gaps:8/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VVPDVIAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKWEADANKLYTLCMTDPDAPSRKD 149
            |:.||:........:..|.|...:..|..:.|:...:.|.|.....:::||||.||||||||..:
plant    13 VIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAVNPPKVNISGHSDELYTLVMTDPDAPSPSE 77

  Fly   150 PKFREWHHWLVGNIPGG-DVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNS 213
            |..|||.||:|.:|||| :.::|:.:..|:  .|.|..|:|||:.:::.|...:....::.|:  
plant    78 PNMREWVHWIVVDIPGGTNPSRGKEILPYM--EPRPPVGIHRYILVLFRQNSPVGLMVQQPPS-- 138

  Fly   214 GDGRGGFKIAEFAKKYALGNPIAGNLYQAE 243
               |..|....||..:.||.|:|...:.|:
plant   139 ---RANFSTRMFAGHFDLGLPVATVYFNAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 47/142 (33%)
E12A11NP_173250.1 PEBP 6..173 CDD:412238 51/160 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.