DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and TFL1

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:138 Identity:47/138 - (34%)
Similarity:71/138 - (51%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VKPGQVLTPTQVKDEPCVKWE-ADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPG-GDVAK 170
            |..|..|.|:.|..:|.|:.. .|....:||.|.|||.|...||..:|..||:|.|||| .|...
plant    40 VSNGHELFPSSVSSKPRVEIHGGDLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATF 104

  Fly   171 GEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPI 235
            |:.:.:|  ..|.|..|:||:||:::.|:      ::|:...:...|..|...:||.:|.||.|:
plant   105 GKEVVSY--ELPRPSIGIHRFVFVLFRQK------QRRVIFPNIPSRDHFNTRKFAVEYDLGLPV 161

  Fly   236 AGNLYQAE 243
            |...:.|:
plant   162 AAVFFNAQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 46/135 (34%)
TFL1NP_196004.1 PEBP 4..177 CDD:412238 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.