DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and Pebp4

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_008769058.2 Gene:Pebp4 / 691997 RGDID:1593295 Length:235 Species:Rattus norvegicus


Alignment Length:149 Identity:50/149 - (33%)
Similarity:77/149 - (51%) Gaps:9/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IVVKPGQVLTPTQVKDEPCVKWE-ADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDV- 168
            :|.|..|..........|.||:. |.....|.|.|.|||||||.:|:.:.|.||:|.||.|.|: 
  Rat    75 VVPKCNQYRRKIMTWQSPIVKFHGALDGAQYLLVMVDPDAPSRSNPRMKYWRHWVVSNITGTDMK 139

  Fly   169 ---AKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYA 230
               .:|.:::.|....|||.||||||.|.:|.|..:    :..:|.:..:.||.:|:.:|.::|.
  Rat   140 SGSIRGNIITDYQPPTPPPTTGLHRYQFFVYLQGDR----DISIPESENENRGAWKLDKFLQQYG 200

  Fly   231 LGNPIAGNLYQAEYDDYVP 249
            |.:|.....:..::|..:|
  Rat   201 LQDPDTSTQFMTQFDGELP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 48/140 (34%)
Pebp4XP_008769058.2 PEBP_euk 60..212 CDD:176644 48/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.