DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and MRPL38

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_115867.2 Gene:MRPL38 / 64978 HGNCID:14033 Length:380 Species:Homo sapiens


Alignment Length:176 Identity:54/176 - (30%)
Similarity:86/176 - (48%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IAKAPAQTAVVEYPGDIV-VKPGQVLTPTQVKDEPCVKWEADANKLYTLCMT-------DPDAPS 146
            :.:.|...|......|:: |..|..:|||:....|.|.:||:...|:||.:|       :|||  
Human   168 VPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDA-- 230

  Fly   147 RKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPN 211
                   |:.|||:.||||..||:|:|...|:...|...:|:||..||:::|...:.|.|...|:
Human   231 -------EYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGIHRLAFLLFKQDQPIDFSEDARPS 288

  Fly   212 NSGD-GRGGFKIAEFAKKYALGNPIAG-NLYQAEYDDYVPILYKQL 255
            .... .:..|:..:|.||:......|| :.:|..:||.|..::.||
Human   289 PCYQLAQRTFRTFDFYKKHQETMTPAGLSFFQCRWDDSVTYIFHQL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 46/151 (30%)
MRPL38NP_115867.2 PEBP_euk 171..321 CDD:176644 48/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.