DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and mrpl38

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_012814540.2 Gene:mrpl38 / 549900 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis


Alignment Length:245 Identity:74/245 - (30%)
Similarity:112/245 - (45%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKDYIRSTGVNVNYSAVNFPAAIRTLKTFSNSILTKEPKPIFAFIAS-QRQYSCEKVGKTMEEHC 84
            ||..:|....|......   |.:|||:.           |:....|. :|......|.:..|.:.
 Frog   132 RKQILRENHRNPELERA---ARLRTLRI-----------PLDEVQAEWERTTGRSHVQRVAEHYG 182

  Fly    85 VVPDVIAKA---PAQTAVVEY-PGDIVVKP---GQVLTPTQVKDEPCVKWEADANKLYTLCMTDP 142
            |..|:...|   |:.|..|:| .||..:.|   |.::||.:....|.|.:||:...|:||.:|:|
 Frog   183 VFKDLFGDATFVPSVTLRVQYNKGDEFLMPVYHGNLVTPAEASGPPEVTFEAEEGSLWTLLLTNP 247

  Fly   143 DAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEK 207
            |...::...  |:..||||||||..|..||.:..|....|...||.||::||:::|..::.|.::
 Frog   248 DGHLKETDS--EYVLWLVGNIPGNQVHSGEQICHYFPPFPAKGTGYHRHIFLLFKQDRRIEFKDE 310

  Fly   208 RLPNNSGDGR-GGFKIAEFAKKYALGNPIAG-NLYQAEYDDYVPILYKQL 255
            ..||.....: ..||..:|.:||......|| ..:|..:||.|..:|.||
 Frog   311 LRPNPCHSLKLRTFKTLDFYRKYEESLTPAGLAFFQCAWDDSVTQVYHQL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 49/147 (33%)
mrpl38XP_012814540.2 PEBP_euk 197..347 CDD:176644 50/151 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.