DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and CG17919

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster


Alignment Length:196 Identity:105/196 - (53%)
Similarity:133/196 - (67%) Gaps:3/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PIFAFIASQRQYSCEKVGKTMEEHCVVPDVIAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPC 124
            |:...:.:.:..|.|:|   ...|.||||||.:.|.|...|.|..::|.|.|..||||||||:|.
  Fly     7 PLVGCLLAVQAGSVEEV---FRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPV 68

  Fly   125 VKWEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLH 189
            |:|:|...:.|||.|||||||||.:|||||:.||::.||.|.|:|.||.::.|:|||||..||||
  Fly    69 VEWDAQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLH 133

  Fly   190 RYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPILYKQ 254
            |||||:|:|..||.|||:|:...|...|..|..|:||..:.|||||||..|||:||||||.|:||
  Fly   134 RYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQ 198

  Fly   255 L 255
            |
  Fly   199 L 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 80/141 (57%)
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 80/144 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452376
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm25702
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
1211.830

Return to query results.
Submit another query.