DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and mrpl38

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_005169545.1 Gene:mrpl38 / 405881 ZFINID:ZDB-GENE-040426-2373 Length:386 Species:Danio rerio


Alignment Length:182 Identity:57/182 - (31%)
Similarity:93/182 - (51%) Gaps:11/182 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVGKTMEEHCVVPDVIAKA---PAQTAVVEYPGD--IVVKPGQVLTPTQVKDEPCVKWEADANKL 134
            ::.:..|.:.:..|:...|   |.....:.|..|  ..|..|..|||:|.:..|.|.:||:.:.|
Zfish   155 QIRRLAEHYGIYKDLFPMAYFTPRVMLRIGYGDDSSAAVHYGNHLTPSQAEQAPHVHYEAEEDSL 219

  Fly   135 YTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQR 199
            :||.:|.||.....:.  :|:.|||||||||..||.|:.:..|:...|...|||||::|::::|.
Zfish   220 WTLLLTSPDEHLLDEE--QEYLHWLVGNIPGRAVASGDQICPYLCPFPARGTGLHRFIFILFKQD 282

  Fly   200 CKLTF--DEKRLPNNSGDGRGGFKIAEFAKKYA-LGNPIAGNLYQAEYDDYV 248
            ..:.|  |.:.:|..|.. |..|:..:|.:|:. |..|.....:|.::|..|
Zfish   283 ALVDFGSDVRPVPCESLK-RRSFQTLDFYRKHQDLITPAGLAFFQCQWDQSV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 50/146 (34%)
mrpl38XP_005169545.1 PEBP_euk 179..327 CDD:176644 50/150 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.