DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and mRpL38

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster


Alignment Length:174 Identity:46/174 - (26%)
Similarity:74/174 - (42%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GDIV--VKPGQVLTPTQVKDEPCVKWE----------ADANKLYTLCMTDPDAPSRKDPKFREWH 156
            ||.:  |..|.|:.||:....|.:.::          |..:..:||..::|||......  .|..
  Fly   156 GDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDAHYTNGT--AECL 218

  Fly   157 HWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFD------------EKRL 209
            ||.:.|||.|.|::|:||:.|:...||...|..|.||::|:|:.:|...            |||.
  Fly   219 HWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSYQLAAADYGNLEKRT 283

  Fly   210 PNNSGDGRGGFKIAEFAKKYALGNPIAG-NLYQAEYDDYVPILY 252
                      |...:|.:::......|| ..||..:|:.:...|
  Fly   284 ----------FSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 43/162 (27%)
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 43/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452375
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.