DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and Pebp1

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_058932.1 Gene:Pebp1 / 29542 RGDID:62017 Length:187 Species:Rattus norvegicus


Alignment Length:165 Identity:100/165 - (60%)
Similarity:119/165 - (72%) Gaps:3/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PAQTAV-VEYPGDIVVKPGQVLTPTQVKDEP-CVKWEA-DANKLYTLCMTDPDAPSRKDPKFREW 155
            |.|.|: |:|.|..|.:.|:|||||||.:.| .:.|:. |..|||||.:||||||||||||||||
  Rat    20 PPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREW 84

  Fly   156 HHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGF 220
            ||:||.|:.|.|::.|.|||.|||||||.||||||||:|:|||...|..||..|.|.|||.||.|
  Rat    85 HHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKF 149

  Fly   221 KIAEFAKKYALGNPIAGNLYQAEYDDYVPILYKQL 255
            |:..|.|||.||.|:||..:|||:||.||.|:.||
  Rat   150 KVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 87/143 (61%)
Pebp1NP_058932.1 PEBP_euk 25..171 CDD:176644 87/145 (60%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 26/40 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343382
Domainoid 1 1.000 155 1.000 Domainoid score I4128
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm8913
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.