DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and SPBC2F12.10

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:57/274 - (20%)
Similarity:105/274 - (38%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLRVLRNLN----RSALNGFRKDYIRSTGVNVNYSAVNFPAAIRTLKTFSNSILTKEPKPIFAFI 65
            ||:||..:|    ||..:....||                                 ..|:|.::
pombe    64 RLQVLSQINLPEVRSKFHKKEIDY---------------------------------TNPVFLYM 95

  Fly    66 ASQRQYSCEK--VGKTMEEHCVVPD--VIAKAPAQTAVVEY--PGDIVVKPGQVLTPTQVKDEP- 123
            ..|:....:|  :.:.:|:..|:.|  :.:.:|:....:.:  ..:..:.||.:|..|.....| 
pombe    96 LKQQWEDYQKLLLLQRLEQMKVIKDSGIGSFSPSVDVQLGFNPENNDSITPGTILPSTVTVKTPW 160

  Fly   124 -------CVKWEADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKG---EVLSAYV 178
                   |.|      ..|::...|.|.|:.:..:|....:||:.||| .:.:|.   :...|:.
pombe   161 LSVLPFNCKK------NHYSVITLDLDVPNYETNRFETHCNWLLTNIP-IEASKRVPIDTSKAFF 218

  Fly   179 GSGPP---PDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLY 240
            ...||   .....||.:.|:..|:.    ....:|:|: ..|..|.::||...|.| .|:..:|:
pombe   219 QYRPPIVHRGEDKHRILTLVLRQKS----SSISIPSNA-LVRERFDLSEFCSIYDL-EPVGAHLW 277

  Fly   241 QAEYD-DYVPILYK 253
            ::.:| |.|.:|.|
pombe   278 RSGWDSDAVALLSK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 35/157 (22%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.