DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and CG30060

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster


Alignment Length:179 Identity:70/179 - (39%)
Similarity:98/179 - (54%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SC------EKVGKTMEEHCVVPDVIAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKWEAD 130
            ||      ||:...::.|.|:|.:.|..|.:...|.||.||.:|||.::...:...:|.::::||
  Fly     4 SCPILCPVEKLVTELKRHHVIPRLFACKPTKVISVLYPCDIDIKPGIMVVINETLKQPIIRFKAD 68

  Fly   131 ANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLI 195
            ....:||.|.|.|.|...:   .||..|:||||||.|||.|:.|.||........:.:||.|||.
  Fly    69 PEHYHTLMMVDLDVPPDNN---TEWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIHRIVFLA 130

  Fly   196 YEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEY 244
            ::|..:|.|||..:|.....|||.|....||:|||||||:|.|.|..|:
  Fly   131 FKQYLELDFDETFVPEGEEKGRGTFNCHNFARKYALGNPMAANFYLVEW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 60/141 (43%)
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 60/145 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452382
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I473
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
88.000

Return to query results.
Submit another query.