DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and Pbp2

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099226.1 Gene:Pbp2 / 246145 RGDID:621707 Length:187 Species:Rattus norvegicus


Alignment Length:168 Identity:98/168 - (58%)
Similarity:118/168 - (70%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEP-CVKWEA-DANKLYTLCMTDPDAPSRKDPKF 152
            :.:.|.....|.|.|..|.:.||||||||||:.| .:.|:. |..|||||.:|||||||||:|.:
  Rat    17 VDEQPQHLLRVTYAGAEVSELGQVLTPTQVKNRPSSITWDGLDPGKLYTLILTDPDAPSRKEPIY 81

  Fly   153 REWHHWLVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGR 217
            |||||:||.|:.|.|::.|:|||.|||||||..|||||||:|:|:|...|..||..|.|.||:.|
  Rat    82 REWHHFLVVNMKGNDISSGKVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLKCDEPILTNRSGNQR 146

  Fly   218 GGFKIAEFAKKYALGNPIAGNLYQAEYDDYVPILYKQL 255
            |.||.|.|.|||.||.|:||..||||:|.|||.|||||
  Rat   147 GKFKAAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 85/143 (59%)
Pbp2NP_001099226.1 PEBP_euk 23..171 CDD:176644 85/147 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4128
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm8913
orthoMCL 1 0.900 - - OOG6_101885
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.