DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and Y69E1A.5

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 / 190551 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans


Alignment Length:177 Identity:61/177 - (34%)
Similarity:90/177 - (50%) Gaps:16/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VGKTMEEHCVVPDVIAKAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKWE---ADANKLYTL 137
            :.....:|.:.|.:|..||.|...:.:.| |.|:||..:....:|:.|  :|.   ||...:||:
 Worm     4 ISAAFAQHEITPKIIENAPKQKLHLCWDG-IQVEPGMTMQVRNLKNAP--RWALPGADPESIYTV 65

  Fly   138 CMTDPDAPSRKDPKFREWHHWLVGNIPGGDVAK----GEVLSAYVGSGPPPDTGLHRYVFLIYEQ 198
            .|.|||..|||:|...||.||||.|||..::..    |:...||....|.|.|.|||||.|::|.
 Worm    66 LMIDPDNLSRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYVILMWEH 130

  Fly   199 RCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYALGNPIAGNLYQAEYD 245
            .      .:|:.......|..|.:.:|.:|..||:|||||.:.|:::
 Worm   131 A------GRRISVPKPSSRAKFNVKQFIEKNKLGDPIAGNFFLAQHE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 54/148 (36%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 54/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.