Sequence 1: | NP_609588.1 | Gene: | CG6180 / 34683 | FlyBaseID: | FBgn0032453 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498385.2 | Gene: | C56G2.4 / 175894 | WormBaseID: | WBGene00016979 | Length: | 538 | Species: | Caenorhabditis elegans |
Alignment Length: | 302 | Identity: | 51/302 - (16%) |
---|---|---|---|
Similarity: | 94/302 - (31%) | Gaps: | 113/302 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 VNYSAVNFPAAIRTLKTF---SNSILTKEPKPIFAF----------------------------- 64
Fly 65 --------IASQRQYSCEKV---GK-------------------------------------TME 81
Fly 82 EHCVVPDVIA---KAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKWEAD------------- 130
Fly 131 -ANKLYTLCMTDPDAPSRKDPKFREWH-HWLVGNIPGGDV--AKGEVLSA--YVGSGPPPDTGLH 189
Fly 190 RYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYAL 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6180 | NP_609588.1 | PEBP_euk | 100..242 | CDD:176644 | 29/151 (19%) |
C56G2.4 | NP_498385.2 | PEBP | <374..454 | CDD:294157 | 20/80 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11362 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |