DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and C56G2.4

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_498385.2 Gene:C56G2.4 / 175894 WormBaseID:WBGene00016979 Length:538 Species:Caenorhabditis elegans


Alignment Length:302 Identity:51/302 - (16%)
Similarity:94/302 - (31%) Gaps:113/302 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNYSAVNFPAAIRTLKTF---SNSILTKEPKPIFAF----------------------------- 64
            :|:.||:||.|.:.||.:   .|...:..|..:..|                             
 Worm   162 INFLAVDFPKATKILKDYEPTENYRPSPNPMVVLVFRNGRADIESPKSEEDFNLPQFMLKHELED 226

  Fly    65 --------IASQRQYSCEKV---GK-------------------------------------TME 81
                    :||...::.||.   ||                                     :.:
 Worm   227 DLVGLSLIVASSDPFAIEKQRLRGKVDYCHSLLQKRLASNPPRHHTILHRLPIDEIDSWLSVSFD 291

  Fly    82 EHCVVPDVIA---KAPAQTAVVEYPGDIVVKPGQVLTPTQVKDEPCVKWEAD------------- 130
            :|.|..:|..   |.|..:..::..||:.:.....|||..:........:::             
 Worm   292 QHQVNGNVCCQRIKLPKTSIFLDPLGDVSISALTTLTPPSISSMRISSSQSNYINYHRQTRNFVE 356

  Fly   131 -ANKLYTLCMTDPDAPSRKDPKFREWH-HWLVGNIPGGDV--AKGEVLSA--YVGSGPPPDTGLH 189
             :|:.::|.:.|.          ...| |||..:||..::  |.|..|:.  ||...|...:..|
 Worm   357 LSNEKFSLAIIDA----------HHGHLHWLEVDIPAANLNAANGNGLTKADYVPLIPKKPSTCH 411

  Fly   190 RYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIAEFAKKYAL 231
            .|:|::..|...:...|... ....:.|..|::..|.:::.|
 Worm   412 SYLFVLLAQPASMQTLESYC-EGMCETRKKFRLELFKQQHGL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 29/151 (19%)
C56G2.4NP_498385.2 PEBP <374..454 CDD:294157 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.