DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and pebp1.1

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:pebp1.1 / 100497751 XenbaseID:XB-GENE-22069563 Length:185 Species:Xenopus tropicalis


Alignment Length:163 Identity:87/163 - (53%)
Similarity:113/163 - (69%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EYP-----GDIVVKP-GQVLTPTQVKDEPCVKWEA-DANKLYTLCMTDPDAPSRKDPKFREWHHW 158
            :||     |.:.|:. |||||||||:..|.::||: |::||||:..||||.||||:....||||:
 Frog    22 KYPLKVAFGSVCVEELGQVLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLGEWHHF 86

  Fly   159 LVGNIPGGDVAKGEVLSAYVGSGPPPDTGLHRYVFLIYEQRCKLTFDEKRLPNNSGDGRGGFKIA 223
            |..|:.|.|::.|.:|:|||||||...||||||..|:|||..::...|:.|.|.|.:.||.||.:
 Frog    87 LAVNVKGNDLSSGCILTAYVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRGKFKAS 151

  Fly   224 EFAKKYALGNPIAGNLYQAEYDDYVPILYKQLG 256
            ||.|||.|..||||..:|||:||:||.||||||
 Frog   152 EFRKKYKLAAPIAGTCFQAEWDDHVPKLYKQLG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 74/147 (50%)
pebp1.1XP_002938131.1 PEBP_euk 24..170 CDD:176644 73/145 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5435
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H57106
Inparanoid 1 1.050 179 1.000 Inparanoid score I3897
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm47464
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.