DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6180 and pebp4

DIOPT Version :9

Sequence 1:NP_609588.1 Gene:CG6180 / 34683 FlyBaseID:FBgn0032453 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 / 100488878 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis


Alignment Length:152 Identity:51/152 - (33%)
Similarity:74/152 - (48%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 EYPGDIVVKPGQVLTPTQVKDEPCVKW-EADANKLYTLCMTDPDAPSRKDPKFREWHHWLVGNIP 164
            ::|..::          :|.|.|.::: :|.....|.|.|.|||||||.|||:|.|.||::.:||
 Frog    64 DFPRSLI----------KVWDYPLLRYSKAQPGLKYVLIMVDPDAPSRWDPKYRYWRHWVLTDIP 118

  Fly   165 GGDVAKGEVL-----SAYVGSGPPPDTGLHRYVFLIYEQRCKLTF----DEKRLPNNSGDGRGGF 220
            |..:..|..|     |||....|||.||.|||.|.:|||...:..    :|.|        |..:
 Frog   119 GWQLLSGRDLTGNDISAYRRPSPPPGTGYHRYQFYLYEQPLWVILYFLPEEIR--------RSTW 175

  Fly   221 KIAEFAKKYALGNPIAGNLYQA 242
            .:..|.::..||.|:|...:.|
 Frog   176 DLKAFVQRNKLGEPVATTQFLA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6180NP_609588.1 PEBP_euk 100..242 CDD:176644 50/150 (33%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 50/150 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2354
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.