DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PICK1 and F54C8.7

DIOPT Version :9

Sequence 1:NP_001285881.1 Gene:PICK1 / 34677 FlyBaseID:FBgn0032447 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_871661.1 Gene:F54C8.7 / 176326 WormBaseID:WBGene00010040 Length:307 Species:Caenorhabditis elegans


Alignment Length:194 Identity:46/194 - (23%)
Similarity:77/194 - (39%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 EELEGTELMYKGLVEHARRMLKAYYDLLQTYKSFGDCFTQISVHEPQQRA-----SEAFRTFGEF 288
            |.|:.....|..:|..|:........:.:..|...:.|.|:|:.|.|.:|     ||..|..||.
 Worm   101 EVLKDIHRRYGLVVAAAKNFSHVLTQMAEAEKKLSESFYQLSMKEEQIKAQCTMTSETMRGVGEQ 165

  Fly   289 HRTLEKDGLGIIKQIKPVLADLGTYLNKAIPDTKLTVRRYADAKFTYLSYCLKVKEMDDEEHGFA 353
            ..:|:       ..::..::.:.|..|:.|.||..|:.....|:..|          |.:.:..:
 Worm   166 AASLD-------ACLRYFISSMETVYNQTITDTLHTIYNTESARIEY----------DVDRNDIS 213

  Fly   354 ALQEPLYRVETGNYEYRLILRCRQDARSKFAKLRTDVLEKMELLECKHAMDLNKQLRSLLESLA 417
            |...|.....|.|.......:| ::.::|:.||:.|...||.|||......:..||..|..:||
 Worm   214 AATNPPQGQLTKNLPVGATEKC-EEKKAKYEKLKNDAKIKMRLLEENRISVVAAQLEKLQSALA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PICK1NP_001285881.1 PDZ_signaling 98..174 CDD:238492
BAR_PICK1 221..436 CDD:153343 46/194 (24%)
F54C8.7NP_871661.1 BAR_Arfaptin 93..293 CDD:153344 46/194 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.