DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6153 and Pithd1

DIOPT Version :9

Sequence 1:NP_001162966.2 Gene:CG6153 / 34675 FlyBaseID:FBgn0032445 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_079687.3 Gene:Pithd1 / 66193 MGIID:1913443 Length:211 Species:Mus musculus


Alignment Length:199 Identity:114/199 - (57%)
Similarity:150/199 - (75%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLS 65
            |.|||||..|||...|...:...:.|:.|.||.:|||:.::||||..:|.|:.||||:|:|.|.|
Mouse     1 MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRS 65

  Fly    66 KYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQLT 130
            |:||||||||||||||||||:||||:||.|.:|||||:.::::||.|:|:|||...:|:|.|.|.
Mouse    66 KFVESDADEELLFNIPFTGNVKLKGVIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPEQTFSLN 130

  Fly   131 RDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANA 195
            ||..||:||:.|:..||:|:|||::...|||.|.|:|:|||||||:||...|.|||||||:.||.
Mouse   131 RDITGELEYATKISRFSNVYHLSIHISKNFGADTTKIFYIGLRGEWTELRRHEVTICNYEASANP 195

  Fly   196 ADHK 199
            |||:
Mouse   196 ADHR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6153NP_001162966.2 PITH 31..175 CDD:283785 85/143 (59%)
Pithd1NP_079687.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 10/18 (56%)
PITH 31..175 CDD:283785 85/143 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842814
Domainoid 1 1.000 198 1.000 Domainoid score I3095
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10678
Inparanoid 1 1.050 252 1.000 Inparanoid score I3192
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54146
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004940
OrthoInspector 1 1.000 - - oto94249
orthoMCL 1 0.900 - - OOG6_102988
Panther 1 1.100 - - LDO PTHR12175
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R927
SonicParanoid 1 1.000 - - X2966
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.