DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6153 and pithd1

DIOPT Version :9

Sequence 1:NP_001162966.2 Gene:CG6153 / 34675 FlyBaseID:FBgn0032445 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_996957.1 Gene:pithd1 / 404606 ZFINID:ZDB-GENE-040426-2366 Length:210 Species:Danio rerio


Alignment Length:199 Identity:118/199 - (59%)
Similarity:151/199 - (75%) Gaps:8/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGHSHDHG--GCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLS 65
            |||.|.||  .|.||.:      |.|:||.||.:||::.::||||..||.||.||||:::|.|.:
Zfish     6 HGHGHGHGCCECEHEPA------ERGVEYELYRRIDIEKLQCLNESRDGDGKLVFKPWDQRTDRN 64

  Fly    66 KYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQLT 130
            |:|||||||||||||||||::|||||||||.:|:|||..:::|||.|:|:|||...:|:|.|:|.
Zfish    65 KFVESDADEELLFNIPFTGSVKLKGIIISGEDDESHPAEIRLFKNIPQMSFDDTSREPEQAFRLN 129

  Fly   131 RDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANA 195
            ||.|.|:||..|:..||:|.|||::...|||.:.||:||||||||:||||.|.|||||||:.||.
Zfish   130 RDPRAELEYPTKIARFSNVEHLSIHVSRNFGAESTRVYYIGLRGEYTEAHRHEVTICNYEAAANP 194

  Fly   196 ADHK 199
            ||||
Zfish   195 ADHK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6153NP_001162966.2 PITH 31..175 CDD:283785 85/143 (59%)
pithd1NP_996957.1 PITH 30..174 CDD:283785 85/143 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587263
Domainoid 1 1.000 195 1.000 Domainoid score I3115
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10678
Inparanoid 1 1.050 256 1.000 Inparanoid score I3150
OMA 1 1.010 - - QHG54146
OrthoDB 1 1.010 - - D1561790at2759
OrthoFinder 1 1.000 - - FOG0004940
OrthoInspector 1 1.000 - - oto41144
orthoMCL 1 0.900 - - OOG6_102988
Panther 1 1.100 - - LDO PTHR12175
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R927
SonicParanoid 1 1.000 - - X2966
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.