DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6153 and Pithd1

DIOPT Version :9

Sequence 1:NP_001162966.2 Gene:CG6153 / 34675 FlyBaseID:FBgn0032445 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_216543.6 Gene:Pithd1 / 298557 RGDID:1308048 Length:211 Species:Rattus norvegicus


Alignment Length:199 Identity:116/199 - (58%)
Similarity:150/199 - (75%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPHGHSHDHGGCSHEASDVDHALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLS 65
            |.|||||..|||...|...:...:.|:.|.||.:|||:.::||||..:|.|:.||||:|:|.|.|
  Rat     1 MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRS 65

  Fly    66 KYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQLT 130
            |:||||||||||||||||||:|||||||.|.:|||||:.::::||.|:|:|||...:|||.|.|.
  Rat    66 KFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPDQTFSLN 130

  Fly   131 RDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANA 195
            ||..||:||:.|:..||:|:|||::...|||.|.|:|:|||||||:||...|.|||||||:.||.
  Rat   131 RDITGELEYATKISRFSNVYHLSIHISKNFGADTTKIFYIGLRGEWTELRRHEVTICNYEASANP 195

  Fly   196 ADHK 199
            |||:
  Rat   196 ADHR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6153NP_001162966.2 PITH 31..175 CDD:283785 87/143 (61%)
Pithd1XP_216543.6 PITH 35..175 CDD:399305 85/139 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6718
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10678
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1561790at2759
OrthoFinder 1 1.000 - - FOG0004940
OrthoInspector 1 1.000 - - oto97770
orthoMCL 1 0.900 - - OOG6_102988
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2966
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.