DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6153 and SPBP35G2.02

DIOPT Version :9

Sequence 1:NP_001162966.2 Gene:CG6153 / 34675 FlyBaseID:FBgn0032445 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001342954.1 Gene:SPBP35G2.02 / 2541314 PomBaseID:SPBP35G2.02 Length:207 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:73/205 - (35%)
Similarity:112/205 - (54%) Gaps:16/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GCSHEASDVD-HALEMGIEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEKRQDLSKYVESDADE 74
            |..|.::|.| |..|.|...:||:.|..:::..|||.....||.||||::.|.|.:..||||||:
pombe     3 GPHHCSADCDEHPFESGPNDTLYSCIRKESIVTLNEAVPDSGKLVFKPWDLRYDDTDIVESDADD 67

  Fly    75 ELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFD---DARAKPDQEFQLTRDARGE 136
            :|||.:||.|...||.|::....:::.|:...:|.||..:.||   |.:|....||.||.:....
pombe    68 QLLFQVPFAGAATLKSILVRIFPNETAPHSFSLFPNRTDLDFDTIGDVQATETFEFPLTFEGSHI 132

  Fly   137 IEYSPKVVTFSSVHHLSLYFPSNFG-EDITRIYYIGLRGEFTEAHYHG---VTICNYESRANAAD 197
            .|:..|...:.::.:|:::|..:.| :|.|:|.||||||.|..  :.|   |||  ||:....:|
pombe   133 FEFPVKTRLYQNLQNLNIFFTKSDGSDDPTQIAYIGLRGSFVP--FKGDPVVTI--YEATPRPSD 193

  Fly   198 H----KEKAF 203
            |    :|:.|
pombe   194 HPKVNQEEVF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6153NP_001162966.2 PITH 31..175 CDD:283785 54/147 (37%)
SPBP35G2.02NP_001342954.1 PITH 24..172 CDD:310651 54/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1907
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10678
Inparanoid 1 1.050 109 1.000 Inparanoid score I1585
OMA 1 1.010 - - QHG54146
OrthoFinder 1 1.000 - - FOG0004940
OrthoInspector 1 1.000 - - oto101617
orthoMCL 1 0.900 - - OOG6_102988
Panther 1 1.100 - - LDO PTHR12175
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R927
SonicParanoid 1 1.000 - - X2966
TreeFam 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.