DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6153 and ZK353.9

DIOPT Version :9

Sequence 1:NP_001162966.2 Gene:CG6153 / 34675 FlyBaseID:FBgn0032445 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_498859.1 Gene:ZK353.9 / 191290 WormBaseID:WBGene00022704 Length:208 Species:Caenorhabditis elegans


Alignment Length:212 Identity:97/212 - (45%)
Similarity:129/212 - (60%) Gaps:12/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HGHSHDHGGCSHEASDVDHALEMG----IEYSLYTKIDLDNVECLNEETDGQGKSVFKPYEKRQD 63
            |||||:   |:.|     |..|:.    ..|.:.:.||::.|..|||..||.||.|||..|||.|
 Worm     4 HGHSHN---CAAE-----HIPEVPGDDVYRYDMVSYIDMEKVTTLNESVDGAGKKVFKVMEKRDD 60

  Fly    64 LSKYVESDADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDARAKPDQEFQ 128
            ..:|||||.|.||||||||||:::|.|:.|.|..|.|||..:::||:|..|:|||...:.|||..
 Worm    61 RLEYVESDCDHELLFNIPFTGHVRLTGLSIIGDEDGSHPAKIRLFKDREAMSFDDCSIEADQEID 125

  Fly   129 LTRDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRA 193
            |.:|.:|.::|..|...|.::|:||:...:|||||.|:||||||||||.......:.|..|||||
 Worm   126 LKQDPQGLVDYPLKASKFGNIHNLSILVDANFGEDETKIYYIGLRGEFQHEFRQRIAIATYESRA 190

  Fly   194 NAADHKEKAFDGVGRAI 210
            ...|||.:..|.|.:.:
 Worm   191 QLKDHKNEIPDAVAKGL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6153NP_001162966.2 PITH 31..175 CDD:283785 73/143 (51%)
ZK353.9NP_498859.1 PITH 30..172 CDD:283785 73/141 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162624
Domainoid 1 1.000 159 1.000 Domainoid score I2497
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10678
Inparanoid 1 1.050 188 1.000 Inparanoid score I2585
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54146
OrthoDB 1 1.010 - - D1561790at2759
OrthoFinder 1 1.000 - - FOG0004940
OrthoInspector 1 1.000 - - oto20819
orthoMCL 1 0.900 - - OOG6_102988
Panther 1 1.100 - - LDO PTHR12175
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R927
SonicParanoid 1 1.000 - - X2966
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.