DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT4 and CCT3

DIOPT Version :9

Sequence 1:NP_609579.1 Gene:CCT4 / 34674 FlyBaseID:FBgn0032444 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_005989.3 Gene:CCT3 / 7203 HGNCID:1616 Length:545 Species:Homo sapiens


Alignment Length:511 Identity:163/511 - (31%)
Similarity:288/511 - (56%) Gaps:14/511 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQMNVLHPAAKMLVELSRA 90
            |:..||.|||.::|.|||.|||:.|.||:....|.:.:||||..||:::.|.|||||.::|:||.
Human    22 VQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRT 86

  Fly    91 QDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCSNKAVEILKQMSTPIELDDRET 155
            ||...|||||||:::||.:|...|..|::.:|||.:..::::..:..:..||::|.|:::.|.:.
Human    87 QDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDM 151

  Fly   156 LIKSASTSLNSKVVSQQSSLLAPIAVDAV--LKVTDPGKETSVDLKNIKVISSL-GGTVEDTELV 217
            ::...::|:.:|.:|:.|||...||:|||  ::..:.|:: .:|:|....:..: ||.:||:.::
Human   152 MLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRK-EIDIKKYARVEKIPGGIIEDSCVL 215

  Fly   218 DGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDMDHNVIVSDYAAMDRVLKEERSYILNIVK 282
            .|::...........:.|:..:|.|:...:...|.:...::.::......|:|:.|..||..:.:
Human   216 RGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE 280

  Fly   283 QIKKSGCNVLLVQKSILRDAVSDLAQHFLDKIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTA 347
            .|.:...:|::.:|.|     ||||||:|.:.....::.|.:.|...:.:....|.::..:....
Human   281 DIIQLKPDVVITEKGI-----SDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELRE 340

  Fly   348 ENL-SSADLVEEVASGTNKFVKITGIQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKL 411
            ::: :.|.|:|....|...|..||..:: .:..:|:.||::|.:|.|..|:|.||:.|.| .|.|
Human   341 DDVGTGAGLLEIKKIGDEYFTFITDCKD-PKACTILLRGASKEILSEVERNLQDAMQVCR-NVLL 403

  Fly   412 RAQIV-GGGAPEIEMALQLAALAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRN 475
            ..|:| ||||.|:.:|..|...::.:.||:.:.:||.|.||||||.||.:|.|.:.|..:|.||.
Human   404 DPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRA 468

  Fly   476 RHAQGE-KNAGINVRKGAITDIFAENVVQPLLVSISSITLATETIRSILKIDDIVN 530
            :|.|.. :..|:|...|.:.|:....:.:||.|.:.:...|.||...:|:|||||:
Human   469 KHTQENCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVS 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT4NP_609579.1 TCP1_delta 18..531 CDD:239454 163/511 (32%)
Cpn60_TCP1 37..529 CDD:278544 155/497 (31%)
CCT3NP_005989.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 1/1 (100%)
chap_CCT_gamma 6..529 CDD:274085 163/511 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D207515at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.