DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and Pou5f2

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_083591.1 Gene:Pou5f2 / 75507 MGIID:1922757 Length:329 Species:Mus musculus


Alignment Length:241 Identity:84/241 - (34%)
Similarity:125/241 - (51%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   653 QPQLQQSTPKPTSGLTVASAMAKLEQSPEETTDLE-ELEQFAKTFKQRRIKLGFTQGDVGLAMGK 716
            |...:.:.|.|...|.....:|    .||:.:.:: |:||.||..:|:|:.||::|.|||.|:|.
Mouse    82 QSSSEDTCPGPYIALRYMPNLA----LPEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGA 142

  Fly   717 LYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPES 781
            ::|...|||||.||||..||..||.||:|||:.|||:.|.   |:..|:..:           |.
Mouse   143 MFGKVLSQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDE---KNLLGICRM-----------EM 193

  Fly   782 ILGR-RRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRIN 845
            ||.: |:::|.|.|..:.:.|||.||...:||.::||.::.||.:.|::::|||.||.|....  
Mouse   194 ILEQARKRRRASRERRIGSNLEKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQMGSW-- 256

  Fly   846 PSLDLD-----SPTGTPLSSHAFGYPPQALNMS---HMQMEGGSGS 883
            |:.|..     ..||:|     |..||....|:   |.......||
Mouse   257 PTNDTSRREDVGATGSP-----FPGPPVCFPMAPGLHFDFPHYEGS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 35/63 (56%)
Homeobox 789..842 CDD:278475 21/52 (40%)
Pou5f2NP_083591.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 113..181 CDD:278582 37/67 (55%)
Homeobox <214..250 CDD:278475 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.