DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and pou2f3

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:XP_005172050.1 Gene:pou2f3 / 553427 ZFINID:ZDB-GENE-060512-299 Length:399 Species:Danio rerio


Alignment Length:387 Identity:171/387 - (44%)
Similarity:209/387 - (54%) Gaps:64/387 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 EEMHQALQLQLHSYIEMVRQLAPEAFPNPNL----------ATQFLLQNSLQALAQFQALQQMKQ 589
            |..|:...::.:. |:..||:..|     ||          .|..|.|.|  .|...|...:|..
Zfish    10 ESQHEQADIEQNG-IDFTRQIKTE-----NLNDSPHSGSSHKTCHLTQGS--PLPPGQLTGEMPS 66

  Fly   590 QQREDPLPSYSTPLAKSPLRSPS---LSPVPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQ 651
            ..   |||.. ..:..|.|.|||   ||......:.....|||.::..|  .:...:.|:.|.:.
Zfish    67 LH---PLPQL-VLMPGSHLSSPSSFLLSQAQSGHQGLSLLPPNLLSLPS--QTQTGLLPHQPGLA 125

  Fly   652 QQPQLQQSTPKPTSGLTVASAMAKLEQS-----------PEETTDLEELEQFAKTFKQRRIKLGF 705
            ..||..     ..|||..:|....|:.|           .:|..||||||||||.||||||||||
Zfish   126 LTPQAM-----GRSGLAGSSMDGHLDMSHLQVPKHVGSPQDEPNDLEELEQFAKAFKQRRIKLGF 185

  Fly   706 TQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINT 770
            ||||||||||||||||||||||||||||||||||||||||||:|||.||:::.:         :|
Zfish   186 TQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLSDAENSPS---------DT 241

  Fly   771 MTSTLSSTP--ESILGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVW 833
            ||:|.:..|  |. .||:|||||||||.::.||||.||.|.||.||||:.:||:|.|:|||:|||
Zfish   242 MTNTTTLPPLMEG-YGRKRKKRTSIETNIKLTLEKRFLDNPKPNSEEITLISEQLAMEKEVVRVW 305

  Fly   834 FCNRRQKEKRINPSLDLDSPTGT-PLSSHAFG--YPPQALNMSHMQMEGGSGSFCGSSISSG 892
            |||||||||||.      .|..| |:..|.|.  .|..:.:.|.:...|.|.|....|.|.|
Zfish   306 FCNRRQKEKRIY------CPVSTSPIKPHNFNPRLPSTSRSFSPLTSGGVSSSSSPGSPSRG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 60/63 (95%)
Homeobox 789..842 CDD:278475 37/52 (71%)
pou2f3XP_005172050.1 POU 161..235 CDD:197673 67/73 (92%)
Homeobox 261..314 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003004
OrthoInspector 1 1.000 - - mtm6509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.