DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and vvl

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster


Alignment Length:222 Identity:110/222 - (49%)
Similarity:138/222 - (62%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 EETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKP 745
            |:|...::||.|||.||||||||||||.|||||:|.||||.||||||.|||||.|||||||||||
  Fly   212 EDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKP 276

  Fly   746 LLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESI-----LGRRRKKRTSIETTVRTTLEKAF 805
            |||||||:||||                  :.:|.||     .||:||||||||.:|:..||:.|
  Fly   277 LLQKWLEEADST------------------TGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHF 323

  Fly   806 LMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLDLDSPT---------------- 854
            ....||:::||:.|::.|.::|||:|||||||||||||:.|...|....                
  Fly   324 HKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHP 388

  Fly   855 -----GTPLSSHAFGYPPQALNMSHMQ 876
                 |:|:.:|:..:.|..|:..:||
  Fly   389 HHDMHGSPMGTHSHSHSPPMLSPQNMQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 54/63 (86%)
Homeobox 789..842 CDD:278475 29/52 (56%)
vvlNP_001303384.1 POU 212..286 CDD:197673 58/73 (79%)
Homeobox 307..360 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.