DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and vvl

DIOPT Version :10

Sequence 1:NP_723763.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_001303384.1 Gene:vvl / 38752 FlyBaseID:FBgn0086680 Length:742 Species:Drosophila melanogaster


Alignment Length:222 Identity:110/222 - (49%)
Similarity:138/222 - (62%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 EETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKP 745
            |:|...::||.|||.||||||||||||.|||||:|.||||.||||||.|||||.|||||||||||
  Fly   212 EDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKP 276

  Fly   746 LLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESI-----LGRRRKKRTSIETTVRTTLEKAF 805
            |||||||:||||                  :.:|.||     .||:||||||||.:|:..||:.|
  Fly   277 LLQKWLEEADST------------------TGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHF 323

  Fly   806 LMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLDLDSPT---------------- 854
            ....||:::||:.|::.|.::|||:|||||||||||||:.|...|....                
  Fly   324 HKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHP 388

  Fly   855 -----GTPLSSHAFGYPPQALNMSHMQ 876
                 |:|:.:|:..:.|..|:..:||
  Fly   389 HHDMHGSPMGTHSHSHSPPMLSPQNMQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_723763.1 PHA03247 <375..675 CDD:223021
POU 691..755 CDD:197673 54/63 (86%)
Homeodomain 787..843 CDD:459649 32/55 (58%)
vvlNP_001303384.1 POU 212..286 CDD:197673 58/73 (79%)
Homeodomain 305..361 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.