DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and Pou3f4

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_058948.1 Gene:Pou3f4 / 29589 RGDID:61947 Length:361 Species:Rattus norvegicus


Alignment Length:342 Identity:139/342 - (40%)
Similarity:170/342 - (49%) Gaps:92/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 LQALAQFQALQQMKQQQREDPLPS------------------YSTPLAKSPLRSPSLSP------ 615
            :|..:.|:..|::.|......:||                  :|:.||.|||....:.|      
  Rat    25 MQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQ 89

  Fly   616 -----------VPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQ-----QQPQLQQSTPKPT 664
                       |..||       |::...|:.|.|.|..:..|.|.|     .||....|.....
  Rat    90 LGAIIHHRSPHVAHHS-------PHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEH 147

  Fly   665 SGLTVASAMAKL----------------------EQSPEETTDLEELEQFAKTFKQRRIKLGFTQ 707
            .|||...|.|..                      :.|.|||...:|||||||.||||||||||||
  Rat   148 GGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQ 212

  Fly   708 GDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMT 772
            .|||||:|.||||.||||||.|||||.|||||||||||||.||||:|||:               
  Rat   213 ADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSS--------------- 262

  Fly   773 STLSSTPESI-----LGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRV 832
               :.:|.||     .||:||||||||.:|:..||..||...||.::|||.|::.|.::|||:||
  Rat   263 ---TGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRV 324

  Fly   833 WFCNRRQKEKRINPSLD 849
            |||||||||||:.|..|
  Rat   325 WFCNRRQKEKRMTPPGD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 54/63 (86%)
Homeobox 789..842 CDD:278475 31/52 (60%)
Pou3f4NP_058948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 9/47 (19%)
POU 186..260 CDD:197673 60/73 (82%)
Homeobox 281..335 CDD:395001 32/53 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..361 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.