DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and Pou6f1

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:XP_006520671.1 Gene:Pou6f1 / 19009 MGIID:102935 Length:610 Species:Mus musculus


Alignment Length:547 Identity:144/547 - (26%)
Similarity:212/547 - (38%) Gaps:144/547 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 TLRKPHVVPSELEHNHHWHGVVCDANGHATRLLHIAPPRAGPTPLP--THQQPPVGEVLPP---- 410
            |:.:|.::|..:.      |.|....|.|...:    |.|....||  |...|..|...||    
Mouse   141 TVTQPLLIPIGIT------GQVAGQQGLAVWTI----PTATVAALPGLTAASPTGGTFKPPLAGL 195

  Fly   411 -----NSTSFSTIVD--PPKEPSIYEQPAPNGRHCRPANKVMRHMSNSPTPPSPLRSLSDCGKSF 468
                 .:|:..|.|.  ||.:.|...||.|                  |..|.||         |
Mouse   196 QAAAVLNTALPTPVQAAPPIQASSPAQPRP------------------PAQPQPL---------F 233

  Fly   469 EEEELELGENCEMPQNLSSKRQARELDSELENEVLDLAPPPKRLAEEQEEEKVASVNP-----PQ 528
            :.:.|.......:||..::               ...||.|          |.....|     |.
Mouse   234 QTQPLLQTTPAILPQPTAA---------------TVAAPTP----------KTVDATPQITVQPA 273

  Fly   529 PVAFAPEEMHQALQLQLHSYIEMVRQL--AP---EAFPN-PNLATQFLLQNSLQALAQFQALQQM 587
            ..||:|..:..|   .|....:::..|  ||   ...|: |.:::|.|..      ||.|.:..:
Mouse   274 GFAFSPGIISAA---SLGGQTQILGSLTTAPVITNTIPSMPGISSQILTN------AQGQVIGAL 329

  Fly   588 ----KQQQREDPLPSYS------TP-------------LAKSPL------RSPSLSPVPRHSKSQ 623
                .......|.|:.|      ||             ||.|||      |.|:....|..|:.|
Mouse   330 PWVVNSASVATPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPQPVAVRKPNTPESPAKSEVQ 394

  Fly   624 QRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTSGLTVASAMAKLEQSP---EETTD 685
            ...|     ..::...:.::|..||::  :|......|...|.....|.:.....:|   |:..:
Mouse   395 PIQP-----TQAVPQPAVILTSPTPAL--KPSAATPIPITCSETPTVSQLVSKPHTPSLDEDGIN 452

  Fly   686 LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKW 750
            |||:.:|||.||.||:.||.||..||.|:....|..:||:.|.|||.|:::.|:..||||:|:||
Mouse   453 LEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKW 517

  Fly   751 LEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEE 815
            |.:|:   .::..|..|:........|       ::||:|||........|...|..|..||.:|
Mouse   518 LMEAE---LRNQEGQQNLMEFVGGEPS-------KKRKRRTSFTPQAIEALNAYFEKNPLPTGQE 572

  Fly   816 ISQLSERLNMDKEVIRVWFCNRRQKEK 842
            |:::::.||.|:||:|||||||||..|
Mouse   573 ITEIAKELNYDREVVRVWFCNRRQTLK 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 31/63 (49%)
Homeobox 789..842 CDD:278475 24/52 (46%)
Pou6f1XP_006520671.1 PHA03247 <48..425 CDD:223021 74/361 (20%)
Pou 448..522 CDD:389985 35/73 (48%)
Homeobox 546..600 CDD:365835 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.