DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and Pou3f3

DIOPT Version :10

Sequence 1:NP_723763.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_032926.2 Gene:Pou3f3 / 18993 MGIID:102564 Length:497 Species:Mus musculus


Alignment Length:53 Identity:13/53 - (24%)
Similarity:20/53 - (37%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PLIFHV----FSNGGAFLYQHIALALRRS--------KSPINICGMIFDSAPG 91
            |:.:|.    .:.|...:..||.:....|        .||:|: |..|..|.|
Mouse   933 PVAYHTGDGCVAAGSVLITPHIIICSNHSSSRKNGHFSSPVNV-GWCFICARG 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_723763.1 PHA03247 <375..675 CDD:223021
POU 691..755 CDD:197673
Homeodomain 787..843 CDD:459649
Pou3f3NP_032926.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..316
POU 311..385 CDD:197673
Homeodomain 404..460 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.