DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm2 and POU5F2

DIOPT Version :9

Sequence 1:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster
Sequence 2:NP_694948.1 Gene:POU5F2 / 134187 HGNCID:26367 Length:328 Species:Homo sapiens


Alignment Length:303 Identity:99/303 - (32%)
Similarity:139/303 - (45%) Gaps:59/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 REDPLPSYSTPLAKS-----PLRSPSLSPVPRHSKSQQRTP----PNSMTA------NSLGMSSA 641
            |.|.|...||..|..     |...|.:.|.|    ...|.|    |:....      ..||.|.|
Human    28 RVDTLTWLSTQAAPGRVMVWPAVRPGICPGP----DVWRIPLGPLPHEFRGWIAPCRPRLGASEA 88

  Fly   642 VMTPNTPSMQQQPQLQQSTPKPTSGLTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFT 706
            ......||       :.:.|.|...|   .::.||....:.:..|:||:|.||..:|:|:.||::
Human    89 GDWLRRPS-------EGALPGPYIAL---RSIPKLPPPEDISGILKELQQLAKELRQKRLSLGYS 143

  Fly   707 QGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTM 771
            |.|||:|:|.|:|...|||||.||||..||..||.||:|||:|||::.::.      .:..:..|
Human   144 QADVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKLRPLLKKWLKEVEAE------NLLGLCKM 202

  Fly   772 TSTLSSTPESILGRRRK-KRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFC 835
                    |.||.:..| :|.|.|..:..:|||.|....|||.::||.::..|.:.|:|:||||.
Human   203 --------EMILQQSGKWRRASRERRIGNSLEKFFQRCPKPTPQQISHIAGCLQLQKDVVRVWFY 259

  Fly   836 NRRQKEKRINPSLDLDSP-----------TGTPLSSH-AFGYP 866
            ||.:...|  |:.|. ||           .|.|:..| ..|.|
Human   260 NRSKMGSR--PTNDA-SPREIVGTAGPPCPGAPVCFHLGLGLP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm2NP_001285877.1 POU 691..755 CDD:197673 36/63 (57%)
Homeobox 789..842 CDD:278475 21/52 (40%)
POU5F2NP_694948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Pou 124..192 CDD:278582 38/67 (57%)
Homeobox <225..261 CDD:278475 16/35 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.