DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and Pou5f2

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_083591.1 Gene:Pou5f2 / 75507 MGIID:1922757 Length:329 Species:Mus musculus


Alignment Length:254 Identity:78/254 - (30%)
Similarity:115/254 - (45%) Gaps:69/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 PRSSTPHSIRSPIAIRSPASSPQQLHHHHHHPLQITPPSSAASLKLSGMLTPSTPTSGTQMSQGT 758
            |..|:|:..|..||                       |..|...:           :.:|.|...
Mouse    57 PLGSSPYEFRGGIA-----------------------PYRACEAR-----------AWSQSSSED 87

  Fly   759 TTPQPKTVASAAAARAAGEPSPEETTDLE-ELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDF 822
            |.|.|..........|.    ||:.:.:: |:||.||..:|:|:.||::|.|||.|:|.::|...
Mouse    88 TCPGPYIALRYMPNLAL----PEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVL 148

  Fly   823 SQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIG------ 881
            |||||.||||..||..||.||:|||:.||::.|.                    ..::|      
Mouse   149 SQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDE--------------------KNLLGICRMEM 193

  Fly   882 ----RRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQ 936
                .|:::|.|.|..|...|||.||...:||.::|:.:|.||.::|::|:|||.||.|
Mouse   194 ILEQARKRRRASRERRIGSNLEKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 34/63 (54%)
Homeobox 886..939 CDD:278475 23/51 (45%)
Pou5f2NP_083591.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 113..181 CDD:278582 36/67 (54%)
Homeobox <214..250 CDD:278475 16/35 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.