DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and Pou5f2

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001075220.2 Gene:Pou5f2 / 680620 RGDID:1589456 Length:335 Species:Rattus norvegicus


Alignment Length:168 Identity:64/168 - (38%)
Similarity:96/168 - (57%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 PEETTDLE-ELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKL 843
            ||:.:.:: |:||.||..:|:|:.||::|.|||.|:|.::|...|||||.||||..||..||.||
  Rat   111 PEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKL 175

  Fly   844 KPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIG----------RRRKKRTSIETTIRGAL 898
            :|||:.||::.|.                    ..::|          .|:::|.|.|..|...|
  Rat   176 RPLLKMWLEEVDE--------------------KNLLGICRMEMILQQARKRRRASRERRIGSNL 220

  Fly   899 EKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQ 936
            ||.||...:||.::|:.:|.||.::|::|:|||.||.|
  Rat   221 EKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 34/63 (54%)
Homeobox 886..939 CDD:278475 23/51 (45%)
Pou5f2NP_001075220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pou 119..187 CDD:395105 36/67 (54%)
homeodomain <220..256 CDD:412151 16/35 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.