DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and pou4f4

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001073527.1 Gene:pou4f4 / 572084 ZFINID:ZDB-GENE-061215-70 Length:343 Species:Danio rerio


Alignment Length:375 Identity:125/375 - (33%)
Similarity:180/375 - (48%) Gaps:77/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 SPQDFAQFHQLLQQRQVALTQQFNSYMELLRSGSLGLAQDDPALTAQVAAAQFLMQSQLQALSQA 665
            |.|.|: .|.:|.:.:..   ..:|..|.:|...|    ..|:|...:.|...      :.|.|.
Zfish     6 SKQPFS-MHPILHEPKYT---PLHSSSEAIRRACL----PTPSLQGNIFAGFD------ETLLQR 56

  Fly   666 SQQLQALQKQQQRQVDEPLQLNHKMTQQPRSSTPHSIRSPIAIR-SPASSPQQLHH------HHH 723
            ::.|.|        ||...|.:|..  :| .:|.|::.:..::. :|.||...|||      |||
Zfish    57 AEALAA--------VDIVAQKSHPF--KP-DATYHTMTTMTSMTCTPTSSSGHLHHPSVLTSHHH 110

  Fly   724 HP------------LQITPPSSAASLKLSGML-TPSTPTSGTQMS---------QGTTTPQPKTV 766
            ||            |...|..|...:..|.:. |.|.|.|  .||         ..:....|..:
Zfish   111 HPHHQPTQGLEGDLLDHLPGISIGGMPGSDVCSTASHPHS--HMSAINHMQHHHPQSMNMHPHGL 173

  Fly   767 ASAAAARAAGEPSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMG--KLYG-NDFSQTTIS 828
            .|.|:....|:..|    |..|||.||:.|||||||||.||.|||.|:.  |:.| ...||:||.
Zfish   174 GSHASLGGVGDSEP----DPRELESFAERFKQRRIKLGVTQADVGSALANLKIPGVGCLSQSTIC 234

  Fly   829 RFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEII--GRRRKKRTSIE 891
            |||:|.||..||..|||:|:.||::|:|            |.:..::.|||.  |.:::|||||.
Zfish   235 RFESLTLSHNNMVALKPILEAWLEEAER------------AQREKMAKPEIFNGGDKKRKRTSIA 287

  Fly   892 TTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRI 941
            ...:.:||..|....:|:||:|..:|::|.::|.||||||||:|||:||:
Zfish   288 APEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRM 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 37/66 (56%)
Homeobox 886..939 CDD:278475 26/52 (50%)
pou4f4NP_001073527.1 POU 184..261 CDD:197673 42/80 (53%)
Homeobox 282..335 CDD:278475 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.