DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and pou2f3

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:XP_005172050.1 Gene:pou2f3 / 553427 ZFINID:ZDB-GENE-060512-299 Length:399 Species:Danio rerio


Alignment Length:344 Identity:149/344 - (43%)
Similarity:186/344 - (54%) Gaps:69/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 SQASQQLQALQKQ---QQRQVDEPLQL-NHKMTQQPRSSTPHSI-----RSPIA----------- 707
            :.|.:|.::..:|   :|..:|...|: ...:...|.|.:.|..     .||:.           
Zfish     3 TDAVEQTESQHEQADIEQNGIDFTRQIKTENLNDSPHSGSSHKTCHLTQGSPLPPGQLTGEMPSL 67

  Fly   708 -------------IRSPASSPQQLHHHHHHPLQITPPS--SAASLKLSGMLTPSTP-------TS 750
                         :.||:|.........|..|.:.||:  |..|...:|:| |..|       ..
Zfish    68 HPLPQLVLMPGSHLSSPSSFLLSQAQSGHQGLSLLPPNLLSLPSQTQTGLL-PHQPGLALTPQAM 131

  Fly   751 GTQMSQGTTTPQPKTVASAAAARAAGEPSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMG 815
            |.....|::......::.....:..|.|. :|..||||||||||.||||||||||||||||||||
Zfish   132 GRSGLAGSSMDGHLDMSHLQVPKHVGSPQ-DEPNDLEELEQFAKAFKQRRIKLGFTQGDVGLAMG 195

  Fly   816 KLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEII 880
            ||||||||||||||||||||||||||||||||:|||.||:.:...|        :..|.:.|.::
Zfish   196 KLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLSDAENSPSDT--------MTNTTTLPPLM 252

  Fly   881 ---GRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRI- 941
               ||:|||||||||.|:..|||.||.|.||.|||||.::::|:|||||||||||||||||||| 
Zfish   253 EGYGRKRKKRTSIETNIKLTLEKRFLDNPKPNSEEITLISEQLAMEKEVVRVWFCNRRQKEKRIY 317

  Fly   942 -------------NPSLDS 947
                         ||.|.|
Zfish   318 CPVSTSPIKPHNFNPRLPS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 60/63 (95%)
Homeobox 886..939 CDD:278475 38/52 (73%)
pou2f3XP_005172050.1 POU 161..235 CDD:197673 67/73 (92%)
Homeobox 261..314 CDD:278475 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003004
OrthoInspector 1 1.000 - - mtm6509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.