DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and POU3F4

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_000298.3 Gene:POU3F4 / 5456 HGNCID:9217 Length:361 Species:Homo sapiens


Alignment Length:368 Identity:146/368 - (39%)
Similarity:179/368 - (48%) Gaps:85/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 SYMELLRSGSLGLAQDDPALTAQVAAAQFLMQSQLQALSQASQQL-------------------- 669
            |...|:.:.|.|:.|..|....|    :.|....||.:......|                    
Human    13 SSTSLVHADSAGMQQGSPFRNPQ----KLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLAT 73

  Fly   670 QALQKQQQRQVDEPLQL----NHKMTQQPRSSTPHSIRSPIAIRSPASSPQQLHH--HHHHP-LQ 727
            ..|.:|..:...|.|||    :|:                        ||...||  |.:|| ..
Human    74 SPLDQQDVKPGREDLQLGAIIHHR------------------------SPHVAHHSPHTNHPNAW 114

  Fly   728 ITPPSSAASLKLSGM-----LTPSTPTSGTQMSQGTTTPQPKTVASAAAARAAGEP--------- 778
            ...|:...|:..||.     ..|....|| .:..|..||.|...::.:......||         
Human   115 GASPAPNPSITSSGQPLNVYSQPGFTVSG-MLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSH 178

  Fly   779 -----SPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK 838
                 |.|||...:|||||||.||||||||||||.|||||:|.||||.||||||.|||||.||||
Human   179 HCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFK 243

  Fly   839 NMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFL 903
            |||||||||.|||::||   .:||   .|.::....:.    ||:||||||||.:::|.||..||
Human   244 NMCKLKPLLNKWLEEAD---SSTG---SPTSIDKIAAQ----GRKRKKRTSIEVSVKGVLETHFL 298

  Fly   904 ANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLD 946
            ...||.::||:.|||.|.:||||||||||||||||||:.|..|
Human   299 KCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 53/63 (84%)
Homeobox 886..939 CDD:278475 34/52 (65%)
POU3F4NP_000298.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 10/31 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 10/47 (21%)
POU 186..260 CDD:197673 59/73 (81%)
Homeobox 281..335 CDD:365835 35/53 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.