DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and pou2f1b

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:XP_005167869.1 Gene:pou2f1b / 323702 ZFINID:ZDB-GENE-030131-2422 Length:702 Species:Danio rerio


Alignment Length:491 Identity:198/491 - (40%)
Similarity:244/491 - (49%) Gaps:134/491 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 DANGGALNLTSDNSRHSTQSPSNSVKSATASPVPVISVPSPVPPMI------SPVLAPSGCGSTT 546
            |.|.||.....|..|.:.|:.| ::.:|.|..:......:|....:      :.:||        
Zfish    34 DENTGAQTNGLDFQRQTVQTTS-AITNAHAQALLQQLTLTPAQQQLLLQQAQAQLLA-------- 89

  Fly   547 PNSMAAAAAAAAAVASTMGSGISPLLALPGMSSPQAQLAAAGLGMNNPLLTGSLSPQDFAQFHQL 611
                ||...:|...:||.|:.||...|.|....|.:|          |:   .::|       ||
Zfish    90 ----AAVQHSAGQQSSTTGASISASAATPITQIPLSQ----------PI---QITP-------QL 130

  Fly   612 LQQRQVALTQQFNSYMELLRSGSLGLAQDDPALTAQVAAAQFLMQSQLQALSQASQQLQALQKQQ 676
            |||:|    ||.|     |......|.|....:..|:..|||:       :||..|..|:|    
Zfish   131 LQQQQ----QQQN-----LNLQQFVLVQPGHPIATQLQPAQFI-------ISQTPQGQQSL---- 175

  Fly   677 QRQVDEPLQLNHKMTQQPRSSTPHSIRSPIAIRSPASSPQQLHHHHHHPLQITPPSSAASLKLSG 741
                   ||..:.:||.|:|..                         :.||..|..:.|:     
Zfish   176 -------LQAQNLLTQLPQSQA-------------------------NLLQTQPSITLAT----- 203

  Fly   742 MLTPSTPTSGTQMSQGTTTPQPKTVASAAAARAAGEPSPEETTDLEELEQFAKTFKQRRIKLGFT 806
              .|:|||...     ..||......:....:....||.||.:||||||||||||||||||||||
Zfish   204 --QPATPTRTI-----AATPIQSLAHTQTTPKHMDTPSLEEPSDLEELEQFAKTFKQRRIKLGFT 261

  Fly   807 QGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQ 871
            |||||||||||||||||||||||||||||||||||||||||:|||:||   :.|.....|.|   
Zfish   262 QGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDA---VCAENQTSDQA--- 320

  Fly   872 ATVSTPEIIG----------RRRKKRTSIETTIRGALEKAFL-ANQKPTSEEITQLADRLSMEKE 925
              :|:|..:|          |||||||||||.||.||||:|| .||||||||||.:||:|:||||
Zfish   321 --LSSPSSLGSPGLGMEGLNRRRKKRTSIETNIRVALEKSFLEQNQKPTSEEITMIADQLNMEKE 383

  Fly   926 VVRVWFCNRRQKEKRINP------------SLDSPT 949
            |:||||||||||||||||            ::.|||
Zfish   384 VIRVWFCNRRQKEKRINPPNNGSAASTPIKAIFSPT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 61/63 (97%)
Homeobox 886..939 CDD:278475 43/53 (81%)
pou2f1bXP_005167869.1 TFIIA 59..>226 CDD:281188 56/262 (21%)
POU 236..309 CDD:197673 68/72 (94%)
Homeobox 343..397 CDD:278475 43/53 (81%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2466
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.