DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and pou3f2a

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_571364.1 Gene:pou3f2a / 30547 ZFINID:ZDB-GENE-980526-139 Length:337 Species:Danio rerio


Alignment Length:353 Identity:148/353 - (41%)
Similarity:180/353 - (50%) Gaps:53/353 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 TQQFNSYMELLRSGSLGLAQDDPALTAQVAAAQFLMQSQ---LQA----LSQASQQLQALQKQQQ 677
            |...|.|..|..|...|..|..|  ......|..|:||:   ||:    |..|.|.|.|      
Zfish     3 TAASNHYSILTSSAEPGSMQQTP--PPAYRDAHSLLQSEYTTLQSSGGTLGHAHQWLTA------ 59

  Fly   678 RQVDEPLQLNHKMTQQPRSSTPHSIRSPIAIRSPASSPQQLH------HHHHHPLQITPPSSAAS 736
                   .|:|.....|..::|...:....:.....||:|.|      ||.....:.|..:...|
Zfish    60 -------ALSHGGEGSPWPASPLGEQDIKPVEELQHSPRQAHLVPQSQHHETAAWRATTTAHMPS 117

  Fly   737 LKLSG--MLTPSTPTSGTQMSQGTTTPQPKTVASAAAARAAGEP----SPEETTDLEELEQFAKT 795
            :..|.  .|..|.|..|....:...:|.         ....|.|    |.|:|...::||||||.
Zfish   118 MSTSNGQSLIYSQPGYGEMHHEEHHSPH---------LSEHGHPQSLHSDEDTPTSDDLEQFAKQ 173

  Fly   796 FKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQA 860
            ||||||||||||.|||||:|.||||.||||||.|||||.|||||||||||||.|||::||    :
Zfish   174 FKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEAD----S 234

  Fly   861 TGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKE 925
            |.|  .|.:|....:.    ||:||||||||.:::||||..||...||.:.||..|||.|.:|||
Zfish   235 TSG--SPTSLDKIAAQ----GRKRKKRTSIEVSVKGALESHFLKCPKPGASEINSLADSLQLEKE 293

  Fly   926 VVRVWFCNRRQKEKRINPSLDSPTGADD 953
            |||||||||||||||:.|......|::|
Zfish   294 VVRVWFCNRRQKEKRMTPQNGPMAGSED 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 53/63 (84%)
Homeobox 886..939 CDD:278475 35/52 (67%)
pou3f2aNP_571364.1 POU 159..233 CDD:197673 57/73 (78%)
Homeobox 254..307 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.