DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and Pou5f1

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001009178.1 Gene:Pou5f1 / 294562 RGDID:1359491 Length:352 Species:Rattus norvegicus


Alignment Length:219 Identity:99/219 - (45%)
Similarity:131/219 - (59%) Gaps:19/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 LQITPPSSAASLKLSGMLTPSTPTSGTQMSQGTTTPQPKTVASAAAARAAGEPSPEETTDL---- 786
            |.:.|.....:|:..|.......::....|.|..|.:|..|.....     ||||||:.|:    
  Rat    77 LGLVPQVGVETLQPEGQAGARVESNSEGASSGPCTARPSAVKLEKV-----EPSPEESQDMKALQ 136

  Fly   787 EELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWL 851
            :|||||||..||:||.||:||.||||.:|.|:|..||||||.|||||.||.||||||:|||:||:
  Rat   137 KELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWV 201

  Fly   852 DDADRTIQATGGVFDPAALQATVSTPEIIGRRRKKRTSIETTIRGALEKAFLANQKPTSEEITQL 916
            ::||..          ..||....:..::..|::||||||..:|..||..||...||:.::||.:
  Rat   202 EEADNN----------ENLQEICKSETLVQARKRKRTSIENRVRWNLENMFLQCPKPSLQQITSI 256

  Fly   917 ADRLSMEKEVVRVWFCNRRQKEKR 940
            |.:|.:|::||||||||||||.||
  Rat   257 AKQLGLERDVVRVWFCNRRQKGKR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 43/63 (68%)
Homeobox 886..939 CDD:278475 30/52 (58%)
Pou5f1NP_001009178.1 POU 131..205 CDD:197673 47/73 (64%)
Homeobox 226..280 CDD:395001 30/53 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.