DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and POU2F3

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001231611.1 Gene:POU2F3 / 25833 HGNCID:19864 Length:438 Species:Homo sapiens


Alignment Length:379 Identity:161/379 - (42%)
Similarity:202/379 - (53%) Gaps:100/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 ELLRSGSLGLAQDDPALTAQVA------AAQFLMQSQLQALSQASQQLQALQKQQQRQVDEPLQL 686
            ::..||.:..:.|..:..:||.      ...|..|.:.:.||.:.||                .|
Human    12 DIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQ----------------TL 60

  Fly   687 NHK---MTQQPRSSTPHSIRSPIAIRSPASSPQQLHHHHHHPLQ--ITPPSSAASL--------- 737
            :|:   ::|.|...:.:.:....|  ||......|     ||||  :..|....|:         
Human    61 SHRPCHLSQGPAMMSGNQMSGLNA--SPCQDMASL-----HPLQQLVLVPGHLQSVSQFLLSQTQ 118

  Fly   738 ---------------KLSGMLTPST--------------PTSGTQ--MSQGTTTPQPKTVASAAA 771
                           :.||:|.|.|              |.|..:  :......|.||.:.|:..
Human   119 PGQQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGG 183

  Fly   772 ARAAGEPSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLS 836
            |        :|.:||||||:|||||||||||||||||||||||||||||||||||||||||||||
Human   184 A--------DEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLS 240

  Fly   837 FKNMCKLKPLLQKWLDDADRTIQATGGVFDPAALQATVSTP-------EIIGRRRKKRTSIETTI 894
            |||||||||||:|||:||:.:..      ||     :||||       |:.||:|||||||||.|
Human   241 FKNMCKLKPLLEKWLNDAESSPS------DP-----SVSTPSSYPSLSEVFGRKRKKRTSIETNI 294

  Fly   895 RGALEKAFLANQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLDSP 948
            |..|||.|..|.||:||||:.:|::|||||||||||||||||||||||..:.:|
Human   295 RLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 60/63 (95%)
Homeobox 886..939 CDD:278475 39/52 (75%)
POU2F3NP_001231611.1 POU 185..259 CDD:197673 67/73 (92%)
Homeobox 286..339 CDD:278475 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4687
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003004
OrthoInspector 1 1.000 - - mtm8655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.