DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and Pou1f1

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:XP_006248036.1 Gene:Pou1f1 / 25517 RGDID:3367 Length:317 Species:Rattus norvegicus


Alignment Length:302 Identity:112/302 - (37%)
Similarity:164/302 - (54%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 PLQLNHKMTQ-QPRSSTPHSIRSPI-AIRSPASSPQQLHHHHHHPLQITPPSSAASLKLSGMLTP 745
            ||:::|...: .|.|:...::.|.: :|.|...:|:.||.:..   ..|..::|..|..|   .|
  Rat    24 PLRMHHSAAEGLPASNHATNVMSTVPSILSLIQTPKCLHTYFS---MTTMGNTATGLHYS---VP 82

  Fly   746 STPTSGTQMS-----QGTTTP------------------QPKTVASAAA----------ARAAGE 777
            |. ..|.|.|     .||.||                  ||.......|          ::...|
  Rat    83 SC-HYGNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEE 146

  Fly   778 PSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCK 842
            |...::.::.||||||..||.||||||:||.:||.|:..::|::||||||.|||.|.|||||.||
  Rat   147 PIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACK 211

  Fly   843 LKPLLQKWLDDADRTIQATGGVFDPAALQATVSTPEIIG---RRRKKRTSIETTIRGALEKAFLA 904
            ||.:|.|||::|::    .|.:::           |.:|   |:||:||:|....:.|||:.|..
  Rat   212 LKAILSKWLEEAEQ----VGALYN-----------EKVGANERKRKRRTTISIAAKDALERHFGE 261

  Fly   905 NQKPTSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLD 946
            :.||:|:||.::|:.|::||||||||||||||:|||:..||:
  Rat   262 HSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 40/63 (63%)
Homeobox 886..939 CDD:278475 28/52 (54%)
Pou1f1XP_006248036.1 POU 150..224 CDD:197673 43/73 (59%)
Homeobox 243..297 CDD:395001 29/53 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.