DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and Pou1f1

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_032875.1 Gene:Pou1f1 / 18736 MGIID:97588 Length:291 Species:Mus musculus


Alignment Length:281 Identity:109/281 - (38%)
Similarity:155/281 - (55%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 IAIRSPASSPQQLHHHHHHPLQITPPSSAASLKLSGM--LTPSTPTS--GTQMS-----QGTTTP 761
            |.:.|.||:...| ..||...:..|.|:.|:..:|..  |..|.|:.  |.|.|     .|:.||
Mouse    13 ITLNSDASAALPL-RMHHSAAECLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTP 76

  Fly   762 ------------------QPKTVASAAA----------ARAAGEPSPEETTDLEELEQFAKTFKQ 798
                              ||......||          ::...||...::.::.||||||..||.
Mouse    77 CLYKFPDHTLSHGFPPLHQPLLAEDPAASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKV 141

  Fly   799 RRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGG 863
            ||||||:||.:||.|:..::|::||||||.|||.|.|||||.||||.:|.|||::|::    .|.
Mouse   142 RRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQ----VGA 202

  Fly   864 VFDPAALQATVSTPEIIG---RRRKKRTSIETTIRGALEKAFLANQKPTSEEITQLADRLSMEKE 925
            :::           |.:|   |:||:||:|....:.|||:.|..:.||:|:||.::|:.|::|||
Mouse   203 LYN-----------EKVGANERKRKRRTTISVAAKDALERHFGEHSKPSSQEIMRMAEELNLEKE 256

  Fly   926 VVRVWFCNRRQKEKRINPSLD 946
            |||||||||||:|||:..||:
Mouse   257 VVRVWFCNRRQREKRVKTSLN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 40/63 (63%)
Homeobox 886..939 CDD:278475 28/52 (54%)
Pou1f1NP_032875.1 POU 124..198 CDD:197673 43/73 (59%)
Homeobox 217..270 CDD:278475 28/52 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.