DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nub and ceh-18

DIOPT Version :9

Sequence 1:NP_001097153.1 Gene:nub / 34669 FlyBaseID:FBgn0085424 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_741758.1 Gene:ceh-18 / 180671 WormBaseID:WBGene00000441 Length:542 Species:Caenorhabditis elegans


Alignment Length:363 Identity:124/363 - (34%)
Similarity:183/363 - (50%) Gaps:107/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 RQVDEPLQLNHK-------MTQQ-----------PRSSTPHSIRSPIAIR-SPA-------SSPQ 716
            |:|.:.||.||.       :.||           |.|:..:.:.:||..: ||.       :||:
 Worm   135 RRVADMLQGNHNGSLNSHFLQQQFAAFKETVDPTPVSTNGNGLLTPITTQLSPLFTSTDAFNSPE 199

  Fly   717 QLHHHHHHPLQ--ITPP----------SSAASLKLSGMLTPS---------TPTSGTQMSQGTTT 760
            :|       ||  :||.          :|.:.|..|.::.||         |||..|    .:.|
 Worm   200 KL-------LQAIMTPSLGFLGANGLGASNSGLLSSPLIAPSPTLLQSLMNTPTQPT----ASLT 253

  Fly   761 P-----QPKTVASAAAAR-----------AAGEPSPEETTDLEELEQFAKTFKQRRIKLGFTQGD 809
            |     :|..|:....|.           .|...|.::..|:.|||.||:|||::|||.||||||
 Worm   254 PKKAENRPPVVSQTLKASKRRLFDDTSRIEAASMSGDDRIDMNELEAFAQTFKKQRIKFGFTQGD 318

  Fly   810 VGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLDDADRTIQATGG-----VFDPAA 869
            ||:|:||.||.|||||||||||||||||||||||:|||::||.|.:..|:  ||     :.|...
 Worm   319 VGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIE--GGATVTDLIDKKT 381

  Fly   870 LQ---------------------ATVSTPEIIGR-----RRKKRTSIETTIRGALEKAFLANQKP 908
            :.                     ::|:...::.|     ||:|||:::...|.||:..|..|.:|
 Worm   382 IHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRP 446

  Fly   909 TSEEITQLADRLSMEKEVVRVWFCNRRQKEKRINPSLD 946
            ..:::|.:|:.|.::::||||||||||||.:|::..::
 Worm   447 DHDKMTDIANSLELDRDVVRVWFCNRRQKMRRVDEPIE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nubNP_001097153.1 DUF4472 315..>399 CDD:291409
POU 791..855 CDD:197673 50/63 (79%)
Homeobox 886..939 CDD:278475 24/52 (46%)
ceh-18NP_741758.1 POU 290..364 CDD:197673 54/73 (74%)
Homeobox 424..477 CDD:278475 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3642
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.