DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and PUB1

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:37/172 - (21%)
Similarity:67/172 - (38%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMSLDDIIKMKF-------NKNKFVNAKNERVQGGSIRKRNSEGG------LRGIQRSRNGTGFI 57
            |...:||:|..|       |....::..|:.|....:....|...      |.|.|...|    |
Yeast    84 KAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENN----I 144

  Fly    58 RKSKFKQETLLKPPKKPTLVMVCNLDYGVDDDDIMELFNQDGVVEKGFVHYD-RDGNSLGTAHLS 121
            .|..:..::..........:.|.:|:..|||:.:...|........|.|.:| :.|:|.|...:|
Yeast   145 VKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVS 209

  Fly   122 FKYREEAFQIIEQFHGVRLDGRRLKLHLV-----QNTRNFKR 158
            |..:::|...::...|..|:||.|:::..     .|..|:::
Yeast   210 FTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRDNNNNNNYQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 20/74 (27%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026 15/69 (22%)
RRM2_PUB1 161..240 CDD:410031 20/78 (26%)
RRM3_PUB1 341..414 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.