DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and YRA1

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_010669.1 Gene:YRA1 / 851988 SGDID:S000002789 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:64/230 - (27%)
Similarity:97/230 - (42%) Gaps:42/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKMKMSLDDIIKMKFNKNKFVNAKNERVQGGSIRKRNSE--GGLRGIQRSR--NGTGFIRKSK 61
            ||..:..|||:||    ..||   |.:.|.:.|..|.....  |...|.||..  |..|.|||: 
Yeast     1 MSANLDKSLDEII----GSNK---AGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKN- 57

  Fly    62 FKQETLLKPPK------------KPTLVMVCNLDYGVDDDDIMELF-NQDGVVEKGFVHYDRDGN 113
                 ...||.            :...|.|..|...:..|.:.|.| :|.|.|::..:.|:..|.
Yeast    58 -----TRAPPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQ 117

  Fly   114 SLGTAHLSFKYREEAFQIIEQFHGVRLDG--RRLKLHLVQNTRNFKRTDVDDLSLRMGSFKTRFL 176
            |.|.|:::||..|.|.:.:|:|:|..:||  .||:|:|:.:.   .:..|..|:.|:.:..    
Yeast   118 STGMANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDP---NQRPVKSLADRIKAMP---- 175

  Fly   177 QNGTFKTRSLQNGFQKSRLFRNSSFKP---RPFKK 208
            |.|....|.::.|..:......|..||   :|.||
Yeast   176 QKGGNAPRPVKRGPNRKAAMAKSQNKPKREKPAKK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 57/214 (27%)
RRM_SF 75..149 CDD:302621 26/76 (34%)
YRA1NP_010669.1 RRM 1..226 CDD:223796 64/230 (28%)
RRM_YRA1_MLO3 78..156 CDD:409711 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I1802
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101458
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.720

Return to query results.
Submit another query.