DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and POLDIP3

DIOPT Version :9

Sequence 1:NP_001246007.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001265586.1 Gene:POLDIP3 / 84271 HGNCID:23782 Length:438 Species:Homo sapiens


Alignment Length:117 Identity:32/117 - (27%)
Similarity:54/117 - (46%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RSRNGTGFIRKSKFKQETLLKPPK-----KPTL-------VMVCNLDYGVDDDDIMELFNQDGVV 101
            |::..|...|....|:|    |||     :|.|       :.|.||...|.::||:|||...|.:
Human   263 RTKALTNMSRTLVNKEE----PPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGAL 323

  Fly   102 EKG-FVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQN 152
            ::. .||       .|.|.:.|..:::|....::::...|||:.:|.:|..|
Human   324 KRARLVH-------PGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_001246007.1 RRM 2..>198 CDD:223796 32/117 (27%)
RRM_SF 75..149 CDD:302621 21/81 (26%)
POLDIP3NP_001265586.1 RRM_SKAR 297..365 CDD:241125 20/74 (27%)
RRM <301..424 CDD:223796 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0533
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19965
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.