DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ref2 and UBP1B

DIOPT Version :10

Sequence 1:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_564018.1 Gene:UBP1B / 838309 AraportID:AT1G17370 Length:419 Species:Arabidopsis thaliana


Alignment Length:132 Identity:33/132 - (25%)
Similarity:47/132 - (35%) Gaps:47/132 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LLKPPKKPTL----------------VMVCNLDYGVDDDDIMELFNQDGVVEK-----------G 104
            ||.||:...:                |.|.|:...|.:..:.|:|...|.||.           |
plant    30 LLAPPQIEPIPSGNLPPGFDPSTCRSVYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKSSYG 94

  Fly   105 FVHYDRDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLV------QNTRNFKRTDVDD 163
            |||| .|..|.|.|.||             .:|..|.|:.:|::..      ::|.:.....|.|
plant    95 FVHY-FDRRSAGLAILS-------------LNGRHLFGQPIKVNWAYASGQREDTSSHFNIFVGD 145

  Fly   164 LS 165
            ||
plant   146 LS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 24/100 (24%)
UBP1BNP_564018.1 RRM1_PUB1 56..126 CDD:410026 24/83 (29%)
RRM2_PUB1 138..217 CDD:410031 4/10 (40%)
RRM3_PUB1 260..336 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.